PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_26765_a_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family M-type_MADS
Protein Properties Length: 69aa    MW: 7862.24 Da    PI: 10.4599
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_26765_a_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.61.4e-32958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    k ienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  Neem_26765_a_1  9 KTIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                    68**********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.6E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.983161IPR002100Transcription factor, MADS-box
CDDcd002657.38E-38261No hitNo description
SuperFamilySSF554558.76E-31261IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-33323IPR002100Transcription factor, MADS-box
PfamPF003194.2E-281157IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004046.3E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MGRGRVELKT IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSS  60
GYIFVLFSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20167167Myocyte-specific enhancer factor 2B
1tqe_Q2e-20167167Myocyte-specific enhancer factor 2B
1tqe_R2e-20167167Myocyte-specific enhancer factor 2B
1tqe_S2e-20167167Myocyte-specific enhancer factor 2B
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475143.15e-37PREDICTED: agamous-like MADS-box protein AGL6 isoform X3
SwissprotQ6EU395e-36MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLC6F9J92e-36C6F9J9_PSEMZ; Truncated MADS-box transcription factor (Fragment)
TrEMBLC6F9M12e-36C6F9M1_9SPER; Truncated MADS-box transcription factor (Fragment)
TrEMBLI1P3522e-36I1P352_ORYGL; Uncharacterized protein
TrEMBLL7RW702e-36L7RW70_LAROX; MADS-box transcription factor
TrEMBLL7S0M62e-36L7S0M6_9SPER; MADS-box transcription factor
TrEMBLU5L2F61e-35U5L2F6_G
STRINGORGLA02G0240800.16e-36(Oryza glaberrima)
STRINGSb04g031750.11e-34(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7828413
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.12e-36AGAMOUS-like 6